PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3DS_833AD0EE2.1
Common NameNF-YB3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YB
Protein Properties Length: 100aa    MW: 11266.7 Da    PI: 6.5192
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3DS_833AD0EE2.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB154.61.7e-481811797
                  NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
                           mkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfedyv+plk yl+k+re+ege+
  Traes_3DS_833AD0EE2.1  1 MKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYVDPLKHYLHKFREIEGER 81
                           9******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471135.64E-34198IPR009072Histone-fold
PfamPF008081.5E-21155IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.101.9E-44198IPR009072Histone-fold
PRINTSPR006151.6E-201937No hitNo description
PROSITE patternPS0068502238IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.6E-203856No hitNo description
PRINTSPR006151.6E-205775No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 100 aa     Download sequence    Send to blast
MKKALPANAK ISKDAKETVQ ECVSEFISFI TGEASDKCQR EKRKTINGDD LLWAMTTLGF  60
EDYVDPLKHY LHKFREIEGE RAAATSTSTT PDMPRNNNNA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A2e-371761893NF-YB
4awl_B2e-371761994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A2e-371761994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU9027871e-167GU902787.1 Triticum monococcum nuclear transcription factor Y subunit B3 mRNA, complete cds.
GenBankJF8307841e-167JF830784.1 Triticum aestivum transcription factor CBF/NF-YB/HAP3 (NF-YB3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003557724.16e-60PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotO233101e-52NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
SwissprotQ9FGJ32e-52NFYB2_ARATH; Nuclear transcription factor Y subunit B-2
TrEMBLF8UMZ59e-71F8UMZ5_WHEAT; Transcription factor CBF/NF-YB/HAP3
TrEMBLG0TEQ59e-71G0TEQ5_TRIMO; Nuclear transcription factor Y subunit B3
TrEMBLW5DIA35e-71W5DIA3_WHEAT; Uncharacterized protein
STRINGBRADI1G60030.12e-59(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.16e-54nuclear factor Y, subunit B3